PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00449.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 316aa    MW: 34330.1 Da    PI: 5.5643
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00449.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.2e-161663148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg W++eEde+l+d + ++G g+W+++++  g+ R++k+c++rw +yl
  Zmw_sc00449.1.g00030.1.sm.mk 16 RGLWSPEEDEKLYDHIIRYGVGCWSSVPKLAGLERCGKSCRLRWTNYL 63
                                  788*******************************************97 PP

2Myb_DNA-binding48.81.7e-1569112146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg+++++E+++++ ++k lG++ W+ Ia+ ++ gRt++++k++w++
  Zmw_sc00449.1.g00030.1.sm.mk  69 RGSFSQQEEDIIISLHKILGNK-WSQIASQLP-GRTDNEIKNFWNS 112
                                   899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.471163IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-231266IPR009057Homeodomain-like
SuperFamilySSF466895.99E-2913110IPR009057Homeodomain-like
SMARTSM007173.4E-131565IPR001005SANT/Myb domain
PfamPF002491.8E-141663IPR001005SANT/Myb domain
CDDcd001676.60E-121963No hitNo description
PROSITE profilePS5129424.92164118IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-2667118IPR009057Homeodomain-like
SMARTSM007171.6E-1468116IPR001005SANT/Myb domain
PfamPF002495.6E-1469112IPR001005SANT/Myb domain
CDDcd001671.10E-1071111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGREAAAPGP RPKLRRGLWS PEEDEKLYDH IIRYGVGCWS SVPKLAGLER CGKSCRLRWT  60
NYLRPDLKRG SFSQQEEDII ISLHKILGNK WSQIASQLPG RTDNEIKNFW NSCIKKKLRQ  120
RGIDPSTHMP LNEDAAAAET NDDCKQQFPS DEHSLGIASA GSDPLAPNSP GISFDPLSVT  180
NVPAMQGSSY GAAHSVRSDN LCDYGGVVDV VSDAATYSAY TGGGDNSSNS NGTRTCGSVI  240
GGEPLTPHMD ILGRDVEPYS FNPAKFSAWN QQHHHHDAGA GAASTFPIQS MSRDLPESCF  300
DLACGALEDE FSVDFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-31121183108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968898.11e-161PREDICTED: myb-related protein Hv33-like
RefseqXP_004968899.11e-161PREDICTED: myb-related protein Hv33-like
SwissprotP200276e-77MYB3_HORVU; Myb-related protein Hv33
TrEMBLA0A0A9D6N41e-165A0A0A9D6N4_ARUDO; Uncharacterized protein
STRINGSi002220m1e-161(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041